PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Cucsa.180090.3
Common NameCsa_4G056770, LOC101210541
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Benincaseae; Cucumis
Family FAR1
Protein Properties Length: 809aa    MW: 94208 Da    PI: 8.0826
Description FAR1 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Cucsa.180090.3genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1FAR187.12.6e-2747133291
            FAR1   2 fYneYAkevGFsvrkskskkskrngeitkrtfvCskegkreeekkktekerrtraetrtgCkaklkvkkekdgkwevtkleleHnHelap 91 
                     fY+eYAk++GF++++++s++sk+++e+++++f Cs++g + e+++    ++r+ ++++t+Cka+++vk++ dg+w ++++ ++HnHel p
  Cucsa.180090.3  47 FYQEYAKSMGFTTSIKNSRRSKKSKEFIDAKFACSRYGVTPESESG---NSRRPSVKKTDCKASMHVKRRPDGRWIIHEFIKDHNHELLP 133
                     ***************************************9998877...7788899*******************************975 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF031015.8E-2547133IPR004330FAR1 DNA binding domain
PfamPF105518.3E-25253346IPR018289MULE transposase domain
PROSITE profilePS509669.371533569IPR007527Zinc finger, SWIM-type
PfamPF044341.3E-5542568IPR007527Zinc finger, SWIM-type
SMARTSM005751.3E-7544571IPR006564Zinc finger, PMZ-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0010018Biological Processfar-red light signaling pathway
GO:0042753Biological Processpositive regulation of circadian rhythm
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0008270Molecular Functionzinc ion binding
Sequence ? help Back to Top
Protein Sequence    Length: 809 aa     Download sequence    Send to blast
MVDVVAEMQD RGGIVSLPKK DILFEGDVDF EPHTGIEFES HEAAYTFYQE YAKSMGFTTS  60
IKNSRRSKKS KEFIDAKFAC SRYGVTPESE SGNSRRPSVK KTDCKASMHV KRRPDGRWII  120
HEFIKDHNHE LLPALAYHFR IHRNVKLAEK NNIDILHAVS ERTRRMYVEM SKQCGGYRNF  180
SFPQIDTTYQ FDKGRYLALD EGDAQMLLEY FKRVQKENPY FFYAIDLNEE QRLRNLFWVD  240
AKSRNDYVSF SDVVSFDISY IKTNDKLPFA PFIGANHHAQ SMVLGCALAA DWTKPTFAWL  300
LKTWLRAMGG KAPKVIITDQ DKALKLAIEE VFPNTRHCFA LWHILEKIPE TLAHVIKRHE  360
NFLAKFNKCI FKSWSDEQFD MRWWKMVTRF ELQDDEWIQS LYGDRKKWVP TYMEDIFLAG  420
MSTTQRSDSM NAFFDKYIHK KITLKEFLRQ YGIILQNRYE EEVIADFDTL HKQPALKSPS  480
PWEKQMSTLY THTIFKKFQV EVLGVVGCRM RKEIEDGTIT TFRVQDCEKD EHFLVRWHKL  540
NSEVSCFCRL FEYKGFLCRH ALIVLQMLDF RSIPSQYILK RWTKDAKSRQ PVTEETEFRQ  600
NRVQRYNDLC KKAIELSEEG SHSEECYNIA IRTLVEALKN CVNINNSKSA PADSCVHAHG  660
LREEEENQGS ITAKANKKKS TNRKRKVQTE TDMILVEAQD NLQPMDSLTS DSMNLTGYYG  720
TQQNVQGLVQ LNLMEPPHDA SYYVSQQSIQ GLGQLNTIAA NHDGFFGVQH NSIHTLVDYR  780
PTTSYSYSLQ EEQHLRSAQL HGSTSRHT*
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00434DAPTransfer from AT4G15090Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankLN6818730.0LN681873.1 Cucumis melo genomic scaffold, anchoredscaffold00027.
GenBankLN7132610.0LN713261.1 Cucumis melo genomic chromosome, chr_7.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004147732.10.0PREDICTED: protein FAR-RED IMPAIRED RESPONSE 1
RefseqXP_011653253.10.0PREDICTED: protein FAR-RED IMPAIRED RESPONSE 1
RefseqXP_011653254.10.0PREDICTED: protein FAR-RED IMPAIRED RESPONSE 1
RefseqXP_011653255.10.0PREDICTED: protein FAR-RED IMPAIRED RESPONSE 1
SwissprotQ9SWG30.0FAR1_ARATH; Protein FAR-RED IMPAIRED RESPONSE 1
TrEMBLA0A0A0KXC80.0A0A0A0KXC8_CUCSA; Uncharacterized protein
STRINGVIT_03s0017g01810.t010.0(Vitis vinifera)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G15090.10.0FAR1 family protein
Publications ? help Back to Top
  1. Ren Y, et al.
    An integrated genetic and cytogenetic map of the cucumber genome.
    PLoS ONE, 2009. 4(6): p. e5795
    [PMID:19495411]
  2. Guo S, et al.
    Transcriptome sequencing and comparative analysis of cucumber flowers with different sex types.
    BMC Genomics, 2010. 11: p. 384
    [PMID:20565788]
  3. Li Z, et al.
    RNA-Seq improves annotation of protein-coding genes in the cucumber genome.
    BMC Genomics, 2011. 12: p. 540
    [PMID:22047402]